PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_013962-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 346aa    MW: 37537 Da    PI: 7.9908
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_013962-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-13103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
    NNU_013962-RA 103 PWTEEEHRLFLMGLQKLGKGDWRGIARNFVISRTPTQVASHAQKY 147
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.19596152IPR017930Myb domain
SuperFamilySSF466897.48E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1899151IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.0E-12100146IPR009057Homeodomain-like
SMARTSM007171.1E-11100150IPR001005SANT/Myb domain
CDDcd001678.62E-10103148No hitNo description
PfamPF002491.1E-11103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGVKLFGVR LTDGSIKKSA SMGNLSSSYF YSSSSAAASP  60
NSASPSSDPL RDQTPVAEGY VSDDPAHASC SSNCRGERKK GVPWTEEEHR LFLMGLQKLG  120
KGDWRGIARN FVISRTPTQV ASHAQKYFIR QSNATRRKRR SSLFDMVPDM SIDRAPAPEE  180
QLVHHSSQAR ESENVNSLPT LHLSLDQESE LMEAIPDETV KADESVKVEN FAAMVPGHFT  240
TYLPIPFPFW PSGLAPAGEE INVGETSHHH QVLKPTPILS KDPFNVDEVV GLSTLSLGEA  300
AAGRIEPSPL TLKLRGAPSR QSAFHANPPV SGSDLSKSNS SIIHAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267150.10.0PREDICTED: uncharacterized protein LOC104604492 isoform X1
TrEMBLV4SSM01e-149V4SSM0_9R
STRINGGLYMA13G43120.11e-141(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-106MYB_related family protein